PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G053900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 590aa    MW: 65570.7 Da    PI: 7.0719
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G053900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.91.2e-1592181199
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         ffkv+    +  s  +v+p +fa++++  +     + led  g +W+v l  +  +g   ++ GWk+Fv ++ + +g+f+vF+ + r+ f 
  Brast01G053900.1.p  92 FFKVM--MGY-FSETMVIPPPFAKKIKDLTG--SNVYLEDAFGLRWRVSL--CSDDGLLSFGHGWKNFVLDHAVGVGEFLVFRQIARTVF- 174
                         67777..334.4556***********76643..47***************..999999*************************8887777. PP

                         .EEEEE-S CS
                  B3  92 lvvkvfrk 99 
                           v++f +
  Brast01G053900.1.p 175 -AVQIFAR 181
                         .8888866 PP

2B330.94.9e-105185822995
                         -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                  B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         kk++ k l++ed++ r+W v +  + +++   + +GW + +++ngL+egD + ++l g+se +++v+
  Brast01G053900.1.p 518 KKQGRKVLVVEDPRARRWPVLY--QCTPRFSGFIAGWVDVCRENGLREGDACELELRGNSELSFRVG 582
                         45567789**************..66666666778*********************99998877775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.26E-2287184IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.4E-2087184IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.70389182IPR003340B3 DNA binding domain
CDDcd100175.44E-1890179No hitNo description
SMARTSM010194.1E-1592182IPR003340B3 DNA binding domain
PfamPF023624.8E-1392181IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-11486580IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-12487579IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0076492587IPR003340B3 DNA binding domain
CDDcd100172.31E-9508581No hitNo description
PfamPF023621.0E-7518582IPR003340B3 DNA binding domain
PROSITE profilePS5086310.01525585IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MLGMVEVKKE QDESMAESQE DEEDVGAKTV SRREEITSRK AEKKKRKMSS DPHRKRACVD  60
CTKRCARVHG RSASPDPENA RRPAAMPTLP SFFKVMMGYF SETMVIPPPF AKKIKDLTGS  120
NVYLEDAFGL RWRVSLCSDD GLLSFGHGWK NFVLDHAVGV GEFLVFRQIA RTVFAVQIFA  180
RSACERLYLC EKNQRQSRKR KKAREKTGKE IVKVSEDNGD RRRRKKQRAS NQQDVALLDA  240
ETETAADCTI LHSEGGTETE NRGGSNFPTS PELATPLATM DLNDEITDDI FLTADVYEFE  300
TDFCDPEAFS LELGLEEHVV ARGQNSGFSC GAEMSSRHRD SSVGVCLENR EMADVPVTSA  360
FAGNDPVLDV GINASHGNEL SVVFGGHKSS EIDAEMPSSE RAIDTSTRAG DNILLAPDGY  420
QIQAEEKEEC SSGKRDNLQL QDGPGQTAEK VMRGNPKRRE RPWLKQKHHM QSGNSNPEAH  480
RSGKTKANNR KFCVAVPPPD QTWLELPCRL PAVVPRAKKQ GRKVLVVEDP RARRWPVLYQ  540
CTPRFSGFIA GWVDVCRENG LREGDACELE LRGNSELSFR VGAPGSSTQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197201RKRKK
2221227RRRKKQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232708.20.0PREDICTED: B3 domain-containing protein Os01g0905400-like
SwissprotQ5N6V04e-80Y1054_ORYSJ; B3 domain-containing protein Os01g0905400
TrEMBLI1HUC80.0I1HUC8_BRADI; Uncharacterized protein
STRINGBRADI2G58030.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP114613240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.14e-11B3 family protein